PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00005682001
Common NameGSBRNA2T00005682001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 304aa    MW: 34908.2 Da    PI: 6.5925
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00005682001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.7e-3971061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +C+aCk+lrr+C+++Cv+ap+fpa+qp+kf  vhk FGasnv kll++l  ++reda++slvyeAe r++dPvyG++g+i+  qq+l+q 
  GSBRNA2T00005682001   7 PCSACKFLRRRCTRECVFAPHFPADQPNKFSWVHKAFGASNVAKLLSELTFNQREDAVTSLVYEAETRIQDPVYGCIGLISLQQQRLKQI 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +++++++e
  GSBRNA2T00005682001  97 QRDTDVARRE 106
                          **99988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.6516107IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-387104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MASSNSPCSA CKFLRRRCTR ECVFAPHFPA DQPNKFSWVH KAFGASNVAK LLSELTFNQR  60
EDAVTSLVYE AETRIQDPVY GCIGLISLQQ QRLKQIQRDT DVARRELATY IGPQAMLPIL  120
QPQQTHLMPQ TPPLQQFVPE TKQAYFMPET QQQTQQPQPE TQQTQFMPQT QETQFMPQTD  180
QTQSMPQTQQ MQFIPQAQQF MPQTQRPSSS SVSAELTQQQ HHDLFPSMAI PTAQLYQQQF  240
FEFQQLEAVA REKHSEMLRA YGEEGSSSSH QHHQNQPQAQ VLRFTDGFDS VVCTDRFCYI  300
NRV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00005682001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660329.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ36e-66LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A078G0240.0A0A078G024_BRANA; BnaA09g07740D protein
STRINGBra037142.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2654433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-66ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]